PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02098.1.p
Common NameEUGRSUZ_C02098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 653aa    MW: 76079.6 Da    PI: 6.8111
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02098.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR136.61.5e-11791204990
              FAR1  49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       ++++++r+etrtgC a++++++ ++++w + +++leHnH ++
  Eucgr.C02098.1.p  79 SEANNPRPETRTGCPAMIVIRLVDSNRWSIVEVQLEHNHRVS 120
                       467899*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.8E-979121IPR004330FAR1 DNA binding domain
PfamPF105511.1E-26243335IPR018289MULE transposase domain
PfamPF044341.0E-4528561IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.446528564IPR007527Zinc finger, SWIM-type
SMARTSM005751.6E-6539566IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MFEMEEVHLN SEPLFDDGNE YEFEEDTNDM DSGGEVSNAQ PMKGHAPPTV GLEFDSFDQA  60
YDFYNMYGKE QGFGIRKKSE ANNPRPETRT GCPAMIVIRL VDSNRWSIVE VQLEHNHRVS  120
PEIKRFYKSH KKMIIAAKKT QPPSKPVMHM RVIKLYQPAA INSGSNGYLS ISRGDGIDSI  180
DHAKYLELKE GDAHALYNYF CRMKLTNPNF FYLMDVDDDG RLRNVFWADA RSRADYAYFS  240
DTVAVDSMCL ANKFEIPLIS FIGINHHGQS VLLGCGFIGH ESVEHFVWIF RAWLKCMLDH  300
PPQVIFTDQS KAFQTAISEV FPKAHHCFCA WYIMQRLHEK LGGLKGYEVI KRQLNRSVFN  360
SLKLAEFETS WADMIHRHGL QDNKWLHSLY EDRQMWVPVY LKDTFFAGMI LIQESESKSA  420
FFDGYVHKHT CFKEFVDKYD LVLHRKHLKE AMSELESRNL NCELKTRCNF EVQLARVYTK  480
EIFKRFQSEV EGMYSCFNTR QINVNGTIIT YIVKERVVTG KEKEVRNYEV LYETSQVDIR  540
CICSLFNYKG YLCRHALNVL NYNGVEEIPR QYILSRWSKD CKRQPLEIPR GSNDVDVHNP  600
AWWHNNLYRR AIPIVEQGAR SKDHYKITLH ELEELLNKLD LVEDNLSAPE NV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02098.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048456.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like
TrEMBLA0A059CR760.0A0A059CR76_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s27240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52520.10.0FAR1-related sequence 6